PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00002.228
Common NameAMTR_s00002p00215130, LOC18429229
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 248aa    MW: 28296.6 Da    PI: 6.2477
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00002.228genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.65e-194295356
                                              --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                                  Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                                              k++++++eq++eLe+ F  ++++  e++ +LA+ lgL+ rqV +WFqNrRa++k
  evm_27.model.AmTr_v1.0_scaffold00002.228 42 KKRRLSAEQVRELEKSFDVENKLEPERKLKLARDLGLQPRQVAIWFQNRRARWK 95
                                              55689************************************************9 PP

2HD-ZIP_I/II126.79.9e-4142133293
                               HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkray 70 
                                               kkrrls+eqv+ LE+sF+ e+kLeperK +lar+Lglqprqva+WFqnrRAR+ktkqlE++y +L+ +y
  evm_27.model.AmTr_v1.0_scaffold00002.228  42 KKRRLSAEQVRELEKSFDVENKLEPERKLKLARDLGLQPRQVAIWFQNRRARWKTKQLEREYGVLRVSY 110
                                               9******************************************************************** PP

                               HD-ZIP_I/II  71 dalkeenerLekeveeLreelke 93 
                                               d+lk++ ++Le+++e+L +el++
  evm_27.model.AmTr_v1.0_scaffold00002.228 111 DSLKHSFKALEHDKERLVSELNQ 133
                                               ******************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.37E-193599IPR009057Homeodomain-like
PROSITE profilePS5007117.1673797IPR001356Homeobox domain
SMARTSM003891.6E-1740101IPR001356Homeobox domain
PfamPF000462.5E-164295IPR001356Homeobox domain
CDDcd000866.18E-174298No hitNo description
Gene3DG3DSA:1.10.10.607.8E-2044103IPR009057Homeodomain-like
PRINTSPR000311.5E-56877IPR000047Helix-turn-helix motif
PROSITE patternPS0002707295IPR017970Homeobox, conserved site
PRINTSPR000311.5E-57793IPR000047Helix-turn-helix motif
PfamPF021831.1E-1597138IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MKRSPSLEDS LGSPVSTYPP MTDDGVWSLK DGFDGEPCGE MKKRRLSAEQ VRELEKSFDV  60
ENKLEPERKL KLARDLGLQP RQVAIWFQNR RARWKTKQLE REYGVLRVSY DSLKHSFKAL  120
EHDKERLVSE LNQLREKLTE GGNVKNGSEV RDGSEESEGS GIDNSPNRPA LISHQLTLAC  180
FAQEEASAPP PTHHLSPPTK PPPYSYHPFS KVEDEHSFMI TDGPFNLFTV EQPPSFPWDL  240
HDHWTYK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18997RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006838583.10.0PREDICTED: homeobox-leucine zipper protein ATHB-16
TrEMBLW1NU600.0W1NU60_AMBTC; Uncharacterized protein
STRINGPOPTR_0007s05010.13e-49(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.17e-45homeobox protein 16
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]